(data stored in ACNUC1104 zone)

EMBL: FN667741.PE132

FN667741.PE132       Location/Qualifiers
FT   CDS             complement(138768..139676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0027"
FT                   /locus_tag="XBJ1_0136"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0136"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79287"
FT                   /db_xref="InterPro:IPR032791"
FT                   /db_xref="InterPro:IPR041444"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYA9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79287.1"
FT                   /translation="MMSQTFIKKEGIAQSFLARYLLSEQCGNRLKTIELLAKECGLSVG
FT                   LMQAALKSLEQAQAVGIKRRGRNGSFLSQINHKLLLEYADIGNVVCAMPLPYTRAYEGL
FT                   ASGLKALCAEIPFYFAHMRGSDIRIECLLNGVYDLAVTSRLAAEQHPENKDLYIALSLG
FT                   TQSYTDRHRLIFRHGEMDSIRRVGLDSTSADQKIMTNQYFEGKEIEVVEVSYHECLNQI
FT                   MKGHIDAAIWNVGQGHELVAQGLMTQLPDDSECFIKASEAVILARKDNIPIQQLLYTMV
FT                   DREALLTHQQNVVAGTIEPVY"
     MMSQTFIKKE GIAQSFLARY LLSEQCGNRL KTIELLAKEC GLSVGLMQAA LKSLEQAQAV        60
     GIKRRGRNGS FLSQINHKLL LEYADIGNVV CAMPLPYTRA YEGLASGLKA LCAEIPFYFA       120
     HMRGSDIRIE CLLNGVYDLA VTSRLAAEQH PENKDLYIAL SLGTQSYTDR HRLIFRHGEM       180
     DSIRRVGLDS TSADQKIMTN QYFEGKEIEV VEVSYHECLN QIMKGHIDAA IWNVGQGHEL       240
     VAQGLMTQLP DDSECFIKAS EAVILARKDN IPIQQLLYTM VDREALLTHQ QNVVAGTIEP       300
     VY                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page