(data stored in ACNUC1104 zone)

EMBL: FN667741.PE142

FN667741.PE142       Location/Qualifiers
FT   CDS             complement(147058..147501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0146"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0146"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79297"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYB9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79297.1"
FT                   /translation="MPKELFTAEIESSGHLKMQCSTRGFSFHVDEPKNLGGTDEAMNPV
FT                   EALLSAFGACQCIVAKSFARKHKINLIDIQVKMEGELDTDGFTGRNKNTKMGFSKITSK
FT                   FYIKADNTEQEIRDFIDFVESNCPVLDTILNAPEIVTEVYPSR"
     MPKELFTAEI ESSGHLKMQC STRGFSFHVD EPKNLGGTDE AMNPVEALLS AFGACQCIVA        60
     KSFARKHKIN LIDIQVKMEG ELDTDGFTGR NKNTKMGFSK ITSKFYIKAD NTEQEIRDFI       120
     DFVESNCPVL DTILNAPEIV TEVYPSR                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page