(data stored in ACNUC1104 zone)

EMBL: FN667741.PE144

FN667741.PE144       Location/Qualifiers
FT   CDS             147759..148037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0030"
FT                   /locus_tag="XBJ1_0148"
FT                   /product="Insertion element IS1 1/2/3/5/6 protein insA
FT                   (IS1a/IS1b/IS1c/IS1d)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0148"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79299"
FT                   /db_xref="InterPro:IPR024431"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYC1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79299.1"
FT                   /translation="MTVTIEVTCRYCDQAEPVRKHGTGKAGFPRYYCKGCQRTFQLNYR
FT                   YNGHKPGMKEKIVDMAMNGSGVRDTGRVLGLGINTVMRTLKNSRQKK"
     MTVTIEVTCR YCDQAEPVRK HGTGKAGFPR YYCKGCQRTF QLNYRYNGHK PGMKEKIVDM        60
     AMNGSGVRDT GRVLGLGINT VMRTLKNSRQ KK                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page