(data stored in ACNUC1104 zone)

EMBL: FN667741.PE150

FN667741.PE150       Location/Qualifiers
FT   CDS             152131..152868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0032"
FT                   /locus_tag="XBJ1_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0154"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79305"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYC7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79305.1"
FT                   /translation="MIIALDFDGVVVDAIDECLLVSWNTFNGKGYQQFNKNTLESIPRS
FT                   FREKFLNYRSYVRHDGHFIVPYYLNDEVFVNKDSFENVYSRISTSDKDRFRNSFIEYRI
FT                   KVRNTYPKVWTSLHKFLMDIETLLNSGNEFIIVSGKDSSSIHFLLCMIGVEFPISKIYG
FT                   RMTNKSETLKSINNKAYMKGEKFIFIDDNLDNVKEAINNDIPSVWAEWGYNTKEQFCEA
FT                   KQLKIPSLKQKDLSDLIKSLHQY"
     MIIALDFDGV VVDAIDECLL VSWNTFNGKG YQQFNKNTLE SIPRSFREKF LNYRSYVRHD        60
     GHFIVPYYLN DEVFVNKDSF ENVYSRISTS DKDRFRNSFI EYRIKVRNTY PKVWTSLHKF       120
     LMDIETLLNS GNEFIIVSGK DSSSIHFLLC MIGVEFPISK IYGRMTNKSE TLKSINNKAY       180
     MKGEKFIFID DNLDNVKEAI NNDIPSVWAE WGYNTKEQFC EAKQLKIPSL KQKDLSDLIK       240
     SLHQY                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page