(data stored in ACNUC1104 zone)

EMBL: FN667741.PE16

FN667741.PE16        Location/Qualifiers
FT   CDS             complement(17217..18575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0004"
FT                   /locus_tag="XBJ1_0016"
FT                   /product="Type I restriction-modification enzyme subunit S"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0016"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79171"
FT                   /db_xref="GOA:D3UXZ3"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXZ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79171.1"
FT                   /translation="MNQIAEGNSKYLAESVGNTLPIGYKQTEAGVIPEAWVVKSIGELA
FT                   NVIRGASPRPKGDKRYYDGKIPRLMVEDVTRDGKFVTPIVDSLTEAGAKLSRPCLRGTL
FT                   TLVCSGNVGIPSILAIDACIHDGFLALTKVSKNISIDYLYHFFSTQREKFNNSATHGGV
FT                   FTNLTTEGVREFLVALPFCYEEQTTIANILSDVDGLISELEKLLAKKQAIKIATMQQLL
FT                   TGRTRLPQFAFREDGSKKGYKRSELREIPEDWNPISIGKDAVLKARIGWQALTTKEYLE
FT                   TGEYYLVTGTNFDAGTVKWEDCWYVSEWRYKQDSNIQLKEDDVLITKDGTIGKVGYVEF
FT                   LRLPSTLNSGVFVIRPKNNAFHPRYLFYILTSKIFNEFMKGITAGSTITHLYQKDFVNF
FT                   NFIAPNIEEQTTIATILLDMDTEIQALKQRLGKTRQIKQGMMQELLTGKTRLI"
     MNQIAEGNSK YLAESVGNTL PIGYKQTEAG VIPEAWVVKS IGELANVIRG ASPRPKGDKR        60
     YYDGKIPRLM VEDVTRDGKF VTPIVDSLTE AGAKLSRPCL RGTLTLVCSG NVGIPSILAI       120
     DACIHDGFLA LTKVSKNISI DYLYHFFSTQ REKFNNSATH GGVFTNLTTE GVREFLVALP       180
     FCYEEQTTIA NILSDVDGLI SELEKLLAKK QAIKIATMQQ LLTGRTRLPQ FAFREDGSKK       240
     GYKRSELREI PEDWNPISIG KDAVLKARIG WQALTTKEYL ETGEYYLVTG TNFDAGTVKW       300
     EDCWYVSEWR YKQDSNIQLK EDDVLITKDG TIGKVGYVEF LRLPSTLNSG VFVIRPKNNA       360
     FHPRYLFYIL TSKIFNEFMK GITAGSTITH LYQKDFVNFN FIAPNIEEQT TIATILLDMD       420
     TEIQALKQRL GKTRQIKQGM MQELLTGKTR LI                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page