(data stored in ACNUC1104 zone)

EMBL: FN667741.PE163

FN667741.PE163       Location/Qualifiers
FT   CDS             162498..162701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0167"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79318"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYE0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79318.1"
FT                   /translation="MGLGQYFLDHQCVDINHAVLNQVQRQHADLMSFARITRHLTTACK
FT                   EYKISYTIPLFGYIQFFVNFPT"
     MGLGQYFLDH QCVDINHAVL NQVQRQHADL MSFARITRHL TTACKEYKIS YTIPLFGYIQ        60
     FFVNFPT                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page