(data stored in ACNUC1104 zone)

EMBL: FN667741.PE166

FN667741.PE166       Location/Qualifiers
FT   CDS             163053..163823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0035"
FT                   /locus_tag="XBJ1_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0170"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79321"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79321.1"
FT                   /translation="MEFDSNSHENAIQEAQRILKEAQTDLALRLEKAVEGVREVAQETM
FT                   HTIGQGGQRALWRTSYFFDSYEDVYQRINREDARVFLAAWSVARGGLFENNVIKKIVDI
FT                   YIDKLLEPHERDQAFLNELYEKLVRSSTIMMHLVAKFKTSGLAKNAVVSAITEAIYVAV
FT                   IKKAFIREGFKKFGMSITLAFQFYGYFDKAAVSASKLKRECPVLYWSFYANEIEMLYFI
FT                   FEPLFKHGISTIKKGKGSNVDDVYLAIMEIVGYN"
     MEFDSNSHEN AIQEAQRILK EAQTDLALRL EKAVEGVREV AQETMHTIGQ GGQRALWRTS        60
     YFFDSYEDVY QRINREDARV FLAAWSVARG GLFENNVIKK IVDIYIDKLL EPHERDQAFL       120
     NELYEKLVRS STIMMHLVAK FKTSGLAKNA VVSAITEAIY VAVIKKAFIR EGFKKFGMSI       180
     TLAFQFYGYF DKAAVSASKL KRECPVLYWS FYANEIEMLY FIFEPLFKHG ISTIKKGKGS       240
     NVDDVYLAIM EIVGYN                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page