(data stored in ACNUC1104 zone)

EMBL: FN667741.PE167

FN667741.PE167       Location/Qualifiers
FT   CDS             163855..164067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0035"
FT                   /locus_tag="XBJ1_0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0171"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79322"
FT                   /db_xref="GOA:D3UYE4"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYE4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79322.1"
FT                   /translation="MFSKGWLRREIMSWLKGIYSYIIWSFIPTLCVFSWSLFAFVIFPN
FT                   HWGLLTVVGIIIVLLFTAYFAFKSN"
     MFSKGWLRRE IMSWLKGIYS YIIWSFIPTL CVFSWSLFAF VIFPNHWGLL TVVGIIIVLL        60
     FTAYFAFKSN                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page