(data stored in ACNUC1104 zone)

EMBL: FN667741.PE17

FN667741.PE17        Location/Qualifiers
FT   CDS             complement(18578..21037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0004"
FT                   /locus_tag="XBJ1_0017"
FT                   /product="Type I restriction-modification enzyme subunit M"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0017"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79172"
FT                   /db_xref="GOA:D3UXZ4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXZ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79172.1"
FT                   /translation="MAIKKNELYSSLWASCDELRGGMDASQYKDYVLTMLFMKYVSDKY
FT                   KNDRYGIIVIPEGAGFDDMVALKGKKDIGDEINKIIRKLADENGLGTMFDVANFNDEEK
FT                   LGKGKEMIDRLSKLVGIFEGLDLSNNYAGGDDLMGDAYEYLMRHFATESGKSKGQFYTP
FT                   AEVSLVLAKIIGINDKTPRDASVYDPTCGSGSLLLKASDEAPRGLSIFGQEMDVTTSSL
FT                   AKMNMILHGHESDVHSIQQGNTIASPVFKDDKGQLKTFDFAVANPPFSNKNWTSGINPR
FT                   EDEFGRFGWGIPPEKNGDYAFLLHILKSLKSTGKGAVILPHGVLFRGNAESLIRENLIK
FT                   QGYIRGIIGLPANLFYGTGIPACIIVLDKQDAISADFDAEGKVTRGRDIFMIDASRDFI
FT                   KDGNKNRLRSQDIYKIVEVFTQQKTLPRFSRTVEFKEIVANDYNLNIPRYIDSSEPEDL
FT                   HDLSAHLQGGIPNRDIDVLDKYWNVFPGIRSTLFATEREGYSHSLVEANQVKDTILNHT
FT                   EFKTFAEQSLKPFAAWCQSAALKEIHRSDNPKELLNDISGYLLINYESVPLLSKYDVYQ
FT                   ILMDYWAETMQDDVYVLVQDDWAAGKKVRELVVKQAEKLKETPDFVIKKTKYKAEIIPP
FT                   ALIIQNYFAGQQVKIDQLQIDADNATQALENYIEENSGDDGLLNDALNDKDKVTKASIT
FT                   ARLKLATDNEEKTVLKQAKELFDAEIDAKKELKKYQEALDLSVLKQYSKLTDDEIKTLV
FT                   VDKKWLATLEANIQAEIERVTQQLTNRVRELEERYAESLPTISKSVDSLSSKVADNLKA
FT                   MGLEWVL"
     MAIKKNELYS SLWASCDELR GGMDASQYKD YVLTMLFMKY VSDKYKNDRY GIIVIPEGAG        60
     FDDMVALKGK KDIGDEINKI IRKLADENGL GTMFDVANFN DEEKLGKGKE MIDRLSKLVG       120
     IFEGLDLSNN YAGGDDLMGD AYEYLMRHFA TESGKSKGQF YTPAEVSLVL AKIIGINDKT       180
     PRDASVYDPT CGSGSLLLKA SDEAPRGLSI FGQEMDVTTS SLAKMNMILH GHESDVHSIQ       240
     QGNTIASPVF KDDKGQLKTF DFAVANPPFS NKNWTSGINP REDEFGRFGW GIPPEKNGDY       300
     AFLLHILKSL KSTGKGAVIL PHGVLFRGNA ESLIRENLIK QGYIRGIIGL PANLFYGTGI       360
     PACIIVLDKQ DAISADFDAE GKVTRGRDIF MIDASRDFIK DGNKNRLRSQ DIYKIVEVFT       420
     QQKTLPRFSR TVEFKEIVAN DYNLNIPRYI DSSEPEDLHD LSAHLQGGIP NRDIDVLDKY       480
     WNVFPGIRST LFATEREGYS HSLVEANQVK DTILNHTEFK TFAEQSLKPF AAWCQSAALK       540
     EIHRSDNPKE LLNDISGYLL INYESVPLLS KYDVYQILMD YWAETMQDDV YVLVQDDWAA       600
     GKKVRELVVK QAEKLKETPD FVIKKTKYKA EIIPPALIIQ NYFAGQQVKI DQLQIDADNA       660
     TQALENYIEE NSGDDGLLND ALNDKDKVTK ASITARLKLA TDNEEKTVLK QAKELFDAEI       720
     DAKKELKKYQ EALDLSVLKQ YSKLTDDEIK TLVVDKKWLA TLEANIQAEI ERVTQQLTNR       780
     VRELEERYAE SLPTISKSVD SLSSKVADNL KAMGLEWVL                              819
//

If you have problems or comments...

PBIL Back to PBIL home page