(data stored in ACNUC1104 zone)

EMBL: FN667741.PE171

FN667741.PE171       Location/Qualifiers
FT   CDS             complement(165515..166297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0036"
FT                   /locus_tag="XBJ1_0175"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0175"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79326"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYE8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79326.1"
FT                   /translation="MKFLCNKRVLSPLLAVFFIQGCAQSGSFSPPINGENVHFMATIPD
FT                   ELDALPISAMYRSKICRKERRTANMKSYSVPGFHHATYPLSIGQSNQVEVSVPKEGGGK
FT                   CDWKLSNLTFEVKLKDTSTIAPLIDDNFGFKTTFVIDGNAPQEFDGGYIKKTGNLNEEI
FT                   TLFPLLRERFLGGHSQSFYLVGEHDVMTYKMDNGRKIHLNVLYEKKFLTHWNGGKNKDA
FT                   DTSMTYPDGTIIYNGDVIPDFDKLMRILESRNSKQTKM"
     MKFLCNKRVL SPLLAVFFIQ GCAQSGSFSP PINGENVHFM ATIPDELDAL PISAMYRSKI        60
     CRKERRTANM KSYSVPGFHH ATYPLSIGQS NQVEVSVPKE GGGKCDWKLS NLTFEVKLKD       120
     TSTIAPLIDD NFGFKTTFVI DGNAPQEFDG GYIKKTGNLN EEITLFPLLR ERFLGGHSQS       180
     FYLVGEHDVM TYKMDNGRKI HLNVLYEKKF LTHWNGGKNK DADTSMTYPD GTIIYNGDVI       240
     PDFDKLMRIL ESRNSKQTKM                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page