(data stored in ACNUC1104 zone)

EMBL: FN667741.PE172

FN667741.PE172       Location/Qualifiers
FT   CDS             complement(166394..167158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0036"
FT                   /locus_tag="XBJ1_0176"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0176"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79327"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYE9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79327.1"
FT                   /translation="MKFLCNKSAFSSLLAVFFIQGCAQSDSFSPPMNGENIHFTATMPD
FT                   ELDALPISAMYRSEICRKERRTANMKSYSVPGFHRATYPLSIGQPNQVEVSVPKEGGGK
FT                   CDWKLSNLTFEVKLKDTSTIAPLIKNNFGFKTTFVIDGNAPQEFDGGYLKINGNLHEKI
FT                   ILFPLLTKLFLSVNETSFYLIGKGDPLTYKVGATKNINLSYIYIKKMLSVWTDRKNNDR
FT                   PFMTYPNGDIVYGEVRPEYEILMRILESRNSK"
     MKFLCNKSAF SSLLAVFFIQ GCAQSDSFSP PMNGENIHFT ATMPDELDAL PISAMYRSEI        60
     CRKERRTANM KSYSVPGFHR ATYPLSIGQP NQVEVSVPKE GGGKCDWKLS NLTFEVKLKD       120
     TSTIAPLIKN NFGFKTTFVI DGNAPQEFDG GYLKINGNLH EKIILFPLLT KLFLSVNETS       180
     FYLIGKGDPL TYKVGATKNI NLSYIYIKKM LSVWTDRKNN DRPFMTYPNG DIVYGEVRPE       240
     YEILMRILES RNSK                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page