(data stored in ACNUC1104 zone)

EMBL: FN667741.PE174

FN667741.PE174       Location/Qualifiers
FT   CDS             complement(167256..168020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0037"
FT                   /locus_tag="XBJ1_0178"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0178"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79329"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYF1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79329.1"
FT                   /translation="MKFLCNKNVLSSLLAVLFIQGCAQSDSFSPPINGEHVHFIATIPD
FT                   ELDALPISAMYRSEICRKERRTANMKSYSVPGFHHATYPLSIGQSNQVEVSVPKEGGGK
FT                   CDWKLSNITFEVKLKDTSTIAPLIDDNIGFKTTFVTDGNAPAVFDGGYLKINGDLHEKI
FT                   ILFPLLTKSFLNGNENTFYLIGKGSPLTYKIGTAKKININYIYIKQMLSVWTGRKNNDM
FT                   PFMTYPNGDIVSGEVRPEYKKLMGILESRNSK"
     MKFLCNKNVL SSLLAVLFIQ GCAQSDSFSP PINGEHVHFI ATIPDELDAL PISAMYRSEI        60
     CRKERRTANM KSYSVPGFHH ATYPLSIGQS NQVEVSVPKE GGGKCDWKLS NITFEVKLKD       120
     TSTIAPLIDD NIGFKTTFVT DGNAPAVFDG GYLKINGDLH EKIILFPLLT KSFLNGNENT       180
     FYLIGKGSPL TYKIGTAKKI NINYIYIKQM LSVWTGRKNN DMPFMTYPNG DIVSGEVRPE       240
     YKKLMGILES RNSK                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page