(data stored in ACNUC1104 zone)

EMBL: FN667741.PE176

FN667741.PE176       Location/Qualifiers
FT   CDS             complement(169966..170760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0037"
FT                   /locus_tag="XBJ1_0180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0180"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79331"
FT                   /db_xref="InterPro:IPR025391"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYF3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79331.1"
FT                   /translation="MENAIPAEDTESPVSWQEWLNKSNDAPVFFILNSLAKPDPVAHFY
FT                   LNDWVEEAFPLYSGTPMRKMLKQSPWLVQAKVNHLFQIGAVLDKHELSDNSWGWAYRSH
FT                   KSWQEQLTHWQRRQLVTLNGEQVIFRMMDTRVFGAMVSAFTPSDWSLMLTPVTELMIDL
FT                   SQTTHFHRPKECGQGNDDIPFTLGEHLQLVWLHSPYGLKVLSSSLYNDLWENHGVMAKK
FT                   LDQPEGSLEPRIEQWLRQKLEAGQRIENMSGQNYLLAMEQEK"
     MENAIPAEDT ESPVSWQEWL NKSNDAPVFF ILNSLAKPDP VAHFYLNDWV EEAFPLYSGT        60
     PMRKMLKQSP WLVQAKVNHL FQIGAVLDKH ELSDNSWGWA YRSHKSWQEQ LTHWQRRQLV       120
     TLNGEQVIFR MMDTRVFGAM VSAFTPSDWS LMLTPVTELM IDLSQTTHFH RPKECGQGND       180
     DIPFTLGEHL QLVWLHSPYG LKVLSSSLYN DLWENHGVMA KKLDQPEGSL EPRIEQWLRQ       240
     KLEAGQRIEN MSGQNYLLAM EQEK                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page