(data stored in ACNUC1104 zone)

EMBL: FN667741.PE180

FN667741.PE180       Location/Qualifiers
FT   CDS             complement(175081..177423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0184"
FT                   /product="Protein yhgF"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0184"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79335"
FT                   /db_xref="GOA:D3UYF7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYF7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79335.1"
FT                   /translation="MNESLSRIIAGELQAQPQQVLAAITLFDEGNTVPFVARYRKEATG
FT                   GLDDTQLRQLESRLGYLRELSDRRQTILKSIEEQGKLTVELAEAINTTQSKTELEDLYL
FT                   PYKPKRRTRGQIAIEAGLEPLADLLWQDPQQTPELAAAAYVDADKGVTDTKAALDGARY
FT                   ILMERFAEDAALLVKVREYLWKNAHLAAKVVEGKEEEGAKFSDYFDHHEPIATVPSHRA
FT                   LAMFRGRNEGILQLALNADPQFEEAPKESYCEQIITDHLNLRLNNAPADSWRKAVVSWT
FT                   WRIKVLLHLETELMGTLREKAEDEAINVFARNLNALMMAAPAGMRATMGLDPGLRTGVK
FT                   VAVVDSTGKLIATDTVYPHTGQEVKAAAAVAALCTKYQVELVAIGNGTASRETERFFAN
FT                   IQKQYPDVKAQAVIVSEAGASVYSASELAALEFPDLDVSLRGAVSIARRLQDPLAELVK
FT                   IDPKSIGVGQYQHDVSQTQLAKKLDTVVEDCVNGVGVDLNTASVALLTRVAGLSKSVAQ
FT                   NIVNWRDENGRFDNRNQLLKVNRLGPKAFLQCAGFLRINQGDNPLDASTVHPETYQVVE
FT                   KILATTEQSLSELMGNPGALRGLQAQDFTTDKFGIPTVTDILKELEKPGRDPRPEFKTA
FT                   TFTDGVETMKDLRAGMILEGTVTNVTNFGAFVDIGVHQDGLVHISSLSDRFVENPHTVV
FT                   KTGDIVKVKVMDIDLNRKRIGLTMRLDEQPGEAPARRSGSQSSNPRNSNERNGNGRNRQ
FT                   TSRSPGSTALSNSAMSDALAAAFGKKR"
     MNESLSRIIA GELQAQPQQV LAAITLFDEG NTVPFVARYR KEATGGLDDT QLRQLESRLG        60
     YLRELSDRRQ TILKSIEEQG KLTVELAEAI NTTQSKTELE DLYLPYKPKR RTRGQIAIEA       120
     GLEPLADLLW QDPQQTPELA AAAYVDADKG VTDTKAALDG ARYILMERFA EDAALLVKVR       180
     EYLWKNAHLA AKVVEGKEEE GAKFSDYFDH HEPIATVPSH RALAMFRGRN EGILQLALNA       240
     DPQFEEAPKE SYCEQIITDH LNLRLNNAPA DSWRKAVVSW TWRIKVLLHL ETELMGTLRE       300
     KAEDEAINVF ARNLNALMMA APAGMRATMG LDPGLRTGVK VAVVDSTGKL IATDTVYPHT       360
     GQEVKAAAAV AALCTKYQVE LVAIGNGTAS RETERFFANI QKQYPDVKAQ AVIVSEAGAS       420
     VYSASELAAL EFPDLDVSLR GAVSIARRLQ DPLAELVKID PKSIGVGQYQ HDVSQTQLAK       480
     KLDTVVEDCV NGVGVDLNTA SVALLTRVAG LSKSVAQNIV NWRDENGRFD NRNQLLKVNR       540
     LGPKAFLQCA GFLRINQGDN PLDASTVHPE TYQVVEKILA TTEQSLSELM GNPGALRGLQ       600
     AQDFTTDKFG IPTVTDILKE LEKPGRDPRP EFKTATFTDG VETMKDLRAG MILEGTVTNV       660
     TNFGAFVDIG VHQDGLVHIS SLSDRFVENP HTVVKTGDIV KVKVMDIDLN RKRIGLTMRL       720
     DEQPGEAPAR RSGSQSSNPR NSNERNGNGR NRQTSRSPGS TALSNSAMSD ALAAAFGKKR       780
//

If you have problems or comments...

PBIL Back to PBIL home page