(data stored in ACNUC1104 zone)

EMBL: FN667741.PE189

FN667741.PE189       Location/Qualifiers
FT   CDS             184932..185780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0040"
FT                   /locus_tag="XBJ1_0193"
FT                   /product="putative amino acid-binding protein (ABC
FT                   superfamily, peri_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0193"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79344"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYG6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79344.1"
FT                   /translation="MKFRNQSRVATVALLTSLALVSGVAKADKLDDIKKTGTVRIAVFD
FT                   SNPPFGFIDPQTKKLAGYDVDIANAVASDLGVKLELRPTNPANRIPLLSSKKIDLIAAN
FT                   FTITDERAKQVNFSIPYFATGQKFIARKGVLKTPDDIAKLRIGADKGTVQEITLRERYP
FT                   TAKVISYDDTPLAFAALRNGNVQAITQDDAKLVGLLANVPEAQKADFEISPFSITREYQ
FT                   AVAATKGEDRLINAVNQTLLKLEKDGDAEKIYNRWFGAETKSAQPRGDFKFAPLDSQAK
FT                   P"
     MKFRNQSRVA TVALLTSLAL VSGVAKADKL DDIKKTGTVR IAVFDSNPPF GFIDPQTKKL        60
     AGYDVDIANA VASDLGVKLE LRPTNPANRI PLLSSKKIDL IAANFTITDE RAKQVNFSIP       120
     YFATGQKFIA RKGVLKTPDD IAKLRIGADK GTVQEITLRE RYPTAKVISY DDTPLAFAAL       180
     RNGNVQAITQ DDAKLVGLLA NVPEAQKADF EISPFSITRE YQAVAATKGE DRLINAVNQT       240
     LLKLEKDGDA EKIYNRWFGA ETKSAQPRGD FKFAPLDSQA KP                          282
//

If you have problems or comments...

PBIL Back to PBIL home page