(data stored in ACNUC1104 zone)

EMBL: FN667741.PE190

FN667741.PE190       Location/Qualifiers
FT   CDS             185857..186594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0040"
FT                   /locus_tag="XBJ1_0194"
FT                   /product="putative glutamate/aspartate transport protein
FT                   (ABC superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0194"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79345"
FT                   /db_xref="GOA:D3UYG7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYG7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79345.1"
FT                   /translation="MFEQFITEHLLAPEYLRWLWQGFLITLWLSVCTIISSTLLGFMIT
FT                   AARDSQIKPLRWLVTAYTTVFRNTPLLVQLFFWYFASGQILPQAAMIWLNTSHEIPIAG
FT                   LTLAWPSFEFLAGFIGLTLYSAPFVAEELRAGIQGIGRGQKYAAHALGLTDWQAMRYVV
FT                   LPQALKIAMPPLLGQYMNIVKNSSLTMAIGVAELSYASRQVETQSLQTFEAFGVATVLY
FT                   IAVIAIMEGWGQWRQQRILVRGY"
     MFEQFITEHL LAPEYLRWLW QGFLITLWLS VCTIISSTLL GFMITAARDS QIKPLRWLVT        60
     AYTTVFRNTP LLVQLFFWYF ASGQILPQAA MIWLNTSHEI PIAGLTLAWP SFEFLAGFIG       120
     LTLYSAPFVA EELRAGIQGI GRGQKYAAHA LGLTDWQAMR YVVLPQALKI AMPPLLGQYM       180
     NIVKNSSLTM AIGVAELSYA SRQVETQSLQ TFEAFGVATV LYIAVIAIME GWGQWRQQRI       240
     LVRGY                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page