(data stored in ACNUC1104 zone)

EMBL: FN667741.PE191

FN667741.PE191       Location/Qualifiers
FT   CDS             186596..187345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0040"
FT                   /locus_tag="XBJ1_0195"
FT                   /product="putative high-affinity glutamine transport
FT                   protein (ABC superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0195"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79346"
FT                   /db_xref="GOA:D3UYG8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYG8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79346.1"
FT                   /translation="MDFTVITENWRYLLLGTFPDGPLEGAALTLVISIMAGVISIVLGT
FT                   VAGVALAMLRGFWVNLLAAILGFFRAIPVIMLIFWTYFLLPVVLGMEIPEITTVVCALA
FT                   LITSAYLAHGVKAGILAIGEGQWRAGLSLGFNRWEVLWYIVLPQALRMMVPSFINQWIA
FT                   LIKDTSLAYIVGVAELSFLATQVNNRSMVYPMEVFLFVALVYFVMCLSLELIANSVARR
FT                   FSMQRQRTTLFGFWRKKTLIMIPKINI"
     MDFTVITENW RYLLLGTFPD GPLEGAALTL VISIMAGVIS IVLGTVAGVA LAMLRGFWVN        60
     LLAAILGFFR AIPVIMLIFW TYFLLPVVLG MEIPEITTVV CALALITSAY LAHGVKAGIL       120
     AIGEGQWRAG LSLGFNRWEV LWYIVLPQAL RMMVPSFINQ WIALIKDTSL AYIVGVAELS       180
     FLATQVNNRS MVYPMEVFLF VALVYFVMCL SLELIANSVA RRFSMQRQRT TLFGFWRKKT       240
     LIMIPKINI                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page