(data stored in ACNUC1104 zone)

EMBL: FN667741.PE197

FN667741.PE197       Location/Qualifiers
FT   CDS             195614..196309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0201"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0201"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79352"
FT                   /db_xref="GOA:D3UYH4"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYH4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79352.1"
FT                   /translation="MRIFMSIKEFIYNVRLNSLLIELMNLDHRLKINDSSLKEEIGYKQ
FT                   FKYHFNPVTSKVYFLLGIIGFSLVLSSSMLLAVLISYVIDSGVNKLAIITCMLLVFSIL
FT                   SLIFFGFLSLGKGNKEGIYIHRILYQSTLVISVLLLLFDSSPFLHFFYYALVMVFSLLI
FT                   KFIMNSYFYFNAVRDMKLFRITHIFLTKDTQEILNMTRKESKKRIKEVEFQRRREIKEK
FT                   KRVKEAAGK"
     MRIFMSIKEF IYNVRLNSLL IELMNLDHRL KINDSSLKEE IGYKQFKYHF NPVTSKVYFL        60
     LGIIGFSLVL SSSMLLAVLI SYVIDSGVNK LAIITCMLLV FSILSLIFFG FLSLGKGNKE       120
     GIYIHRILYQ STLVISVLLL LFDSSPFLHF FYYALVMVFS LLIKFIMNSY FYFNAVRDMK       180
     LFRITHIFLT KDTQEILNMT RKESKKRIKE VEFQRRREIK EKKRVKEAAG K                231
//

If you have problems or comments...

PBIL Back to PBIL home page