(data stored in ACNUC1104 zone)

EMBL: FN667741.PE202

FN667741.PE202       Location/Qualifiers
FT   CDS             complement(199038..200507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0206"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0206"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79357"
FT                   /db_xref="GOA:D3UYH9"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYH9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79357.1"
FT                   /translation="MRFFDTSSYRMPLFLWITGYALLWVVASYTLDPTVPYDAVEALNW
FT                   GINGEWGSPKNPWLVGSVMLPAIHISTISLSFYWYLTHFLAIAIGMLGVWRLAFRLTGK
FT                   VELAWLAMLTLNLSGIINFDIIPYNDNYLLVMLWPWALLFFLRAIDDHPKWWLAFALTT
FT                   GLATMGKYSSLSIIGSVFLLSLFVPRVRRSYREPLFYLAIALWFMLILPNVWWLVHNDF
FT                   AAFKWVDSQIQQGFNLHTTRAVLSVFYPLLIVGAFIYLSGGRIGWPKQQSNALANIVIL
FT                   LPLLLIYGWFSFNQGGRMTEWLQPFMTVAPALLVGSLTVLPRKPLKNTLRGLAVFAVLV
FT                   WIGYVGVMITNVRGAGQKFVGIKTFANQLDQRWNELYPTPLRYVGGEYLHQWLTFYSHY
FT                   RPETIQPWELGNGEPPNVYNRHIKESSIVKEGALLVGEKGKSCEQENFQSTLKQWPVLV
FT                   ISYKEEFSFRPQPSAKTETVCIGFVTPENNQ"
     MRFFDTSSYR MPLFLWITGY ALLWVVASYT LDPTVPYDAV EALNWGINGE WGSPKNPWLV        60
     GSVMLPAIHI STISLSFYWY LTHFLAIAIG MLGVWRLAFR LTGKVELAWL AMLTLNLSGI       120
     INFDIIPYND NYLLVMLWPW ALLFFLRAID DHPKWWLAFA LTTGLATMGK YSSLSIIGSV       180
     FLLSLFVPRV RRSYREPLFY LAIALWFMLI LPNVWWLVHN DFAAFKWVDS QIQQGFNLHT       240
     TRAVLSVFYP LLIVGAFIYL SGGRIGWPKQ QSNALANIVI LLPLLLIYGW FSFNQGGRMT       300
     EWLQPFMTVA PALLVGSLTV LPRKPLKNTL RGLAVFAVLV WIGYVGVMIT NVRGAGQKFV       360
     GIKTFANQLD QRWNELYPTP LRYVGGEYLH QWLTFYSHYR PETIQPWELG NGEPPNVYNR       420
     HIKESSIVKE GALLVGEKGK SCEQENFQST LKQWPVLVIS YKEEFSFRPQ PSAKTETVCI       480
     GFVTPENNQ                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page