(data stored in ACNUC1104 zone)

EMBL: FN667741.PE209

FN667741.PE209       Location/Qualifiers
FT   CDS             complement(211001..212764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0044"
FT                   /locus_tag="XBJ1_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0213"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79364"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYI6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79364.1"
FT                   /translation="MSNKLPAPILPQINNDTLDLKKIEGDIIIKIDNSAQVFFDRDSIM
FT                   ACFNTICGESYTVRNYTESYFEIKIPKNKISPGQYLVHYTVINNDDNISYSPITHIKVI
FT                   DGTPTTPPSDKEPFIVMGARYADLAVANGLKTPQRLTAWTKEGKPHPVTWTYIGGTPSF
FT                   TSPFSHINSPFFYDSAPWLPISVQDEQGNKLKINPINVFGNGGTLGLPKADFNDPLEEQ
FT                   YPSAFAVLLNDNTMVGWGGTFGNSYTQSGVKTITTNGPSYAGLNVDSGTLWYHGDSNHS
FT                   NFPTGSFDDVGAGGNSFFAISHTNQQMEAWGAMTGIFNYPGDGKNVFVGNSFAITIYNP
FT                   GTEQIQSLWGSSMENWQLDPDPRYSSVSKPRYITSMARGFAVIDESGDLSTWGDSSVFV
FT                   GFNPSHQDFIQAASITPFLMNFNVPFGNYAVHRDGTLYAWSVPASSSDGDSCSNGVDIA
FT                   TTKQKFLMPGGTPPHGKIYWDGIQNYNDGPVFEEFMALKDVVQITCSANASAALRQDGT
FT                   VLTWQNAEPSNVNFIPQPEIKNVRAIYSTGTAFLALTADNKVHTWGGSDGGGDSNEVQA
FT                   LLQGKLTYYMD"
     MSNKLPAPIL PQINNDTLDL KKIEGDIIIK IDNSAQVFFD RDSIMACFNT ICGESYTVRN        60
     YTESYFEIKI PKNKISPGQY LVHYTVINND DNISYSPITH IKVIDGTPTT PPSDKEPFIV       120
     MGARYADLAV ANGLKTPQRL TAWTKEGKPH PVTWTYIGGT PSFTSPFSHI NSPFFYDSAP       180
     WLPISVQDEQ GNKLKINPIN VFGNGGTLGL PKADFNDPLE EQYPSAFAVL LNDNTMVGWG       240
     GTFGNSYTQS GVKTITTNGP SYAGLNVDSG TLWYHGDSNH SNFPTGSFDD VGAGGNSFFA       300
     ISHTNQQMEA WGAMTGIFNY PGDGKNVFVG NSFAITIYNP GTEQIQSLWG SSMENWQLDP       360
     DPRYSSVSKP RYITSMARGF AVIDESGDLS TWGDSSVFVG FNPSHQDFIQ AASITPFLMN       420
     FNVPFGNYAV HRDGTLYAWS VPASSSDGDS CSNGVDIATT KQKFLMPGGT PPHGKIYWDG       480
     IQNYNDGPVF EEFMALKDVV QITCSANASA ALRQDGTVLT WQNAEPSNVN FIPQPEIKNV       540
     RAIYSTGTAF LALTADNKVH TWGGSDGGGD SNEVQALLQG KLTYYMD                     587
//

If you have problems or comments...

PBIL Back to PBIL home page