(data stored in ACNUC1104 zone)

EMBL: FN667741.PE211

FN667741.PE211       Location/Qualifiers
FT   CDS             complement(214478..215995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0045"
FT                   /locus_tag="XBJ1_0215"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0215"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79366"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYI8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79366.1"
FT                   /translation="MIKVSVSVKPNSDVIISQEFIAEIKLTSNIPIDNSISISLENTSY
FT                   ISPVGKISSFTPSYNNTSGSFFVRLLVSDKITSGELVSFDIKSSYFGTKHVEYVAKHIQ
FT                   QETLSLKFYKKYLPTPDQPNFPSQGEICSKVMTTIKSSDGQPLSGTPIFIPYLYNFKDF
FT                   DIYDSEKNKIEVTSAPMKGFFINSNEKGEVIFYVYPHIGVATKITLDSMIYNATSSIHS
FT                   MNELYVASSQPQGNDSLLDPPDIENIHGENLTSPNSFIFKTKVDQYDNAKSQDTILFFV
FT                   NNIFTGYAFTIESIDDLGGYSIKLPYKIFEKYKDVACSFYYIIFSVNENVYYSYPLSIV
FT                   FKGGVPNTPQPDINRIYNTCVVYNSAGISPDNILQEMDYVDSTEISNYRNNPDNAGLFV
FT                   QIMGTNDLKDNSNVPLGSEVFLNLYINSSTKTVHHSLKKTMQNLPDGNNNSAKLIFNIP
FT                   HSCLIDCLAYPDRGGDIYFDYQIGFDNDDDLTYGKVWQGRIDTPIID"
     MIKVSVSVKP NSDVIISQEF IAEIKLTSNI PIDNSISISL ENTSYISPVG KISSFTPSYN        60
     NTSGSFFVRL LVSDKITSGE LVSFDIKSSY FGTKHVEYVA KHIQQETLSL KFYKKYLPTP       120
     DQPNFPSQGE ICSKVMTTIK SSDGQPLSGT PIFIPYLYNF KDFDIYDSEK NKIEVTSAPM       180
     KGFFINSNEK GEVIFYVYPH IGVATKITLD SMIYNATSSI HSMNELYVAS SQPQGNDSLL       240
     DPPDIENIHG ENLTSPNSFI FKTKVDQYDN AKSQDTILFF VNNIFTGYAF TIESIDDLGG       300
     YSIKLPYKIF EKYKDVACSF YYIIFSVNEN VYYSYPLSIV FKGGVPNTPQ PDINRIYNTC       360
     VVYNSAGISP DNILQEMDYV DSTEISNYRN NPDNAGLFVQ IMGTNDLKDN SNVPLGSEVF       420
     LNLYINSSTK TVHHSLKKTM QNLPDGNNNS AKLIFNIPHS CLIDCLAYPD RGGDIYFDYQ       480
     IGFDNDDDLT YGKVWQGRID TPIID                                             505
//

If you have problems or comments...

PBIL Back to PBIL home page