(data stored in ACNUC1104 zone)

EMBL: FN667741.PE215

FN667741.PE215       Location/Qualifiers
FT   CDS             218348..218566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0219"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0219"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79370"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYJ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79370.1"
FT                   /translation="MSRARVQSFFWRSLDTLYGLEGLKPLSSGRPRRWPFELICSLLRH
FT                   LISDSPDVLGYQRSRGVIDIINYKSMR"
     MSRARVQSFF WRSLDTLYGL EGLKPLSSGR PRRWPFELIC SLLRHLISDS PDVLGYQRSR        60
     GVIDIINYKS MR                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page