(data stored in ACNUC1104 zone)

EMBL: FN667741.PE218

FN667741.PE218       Location/Qualifiers
FT   CDS             219913..221022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0046"
FT                   /locus_tag="XBJ1_0222"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0222"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79373"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYJ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79373.1"
FT                   /translation="MRIDSINFKPLPIDFEIESIEVTNFTSQHSLPGDGNSAYEYRAKI
FT                   INKTNGKKISNYSFDPKQVNWSREPKRSPKLVDEKDLVLFDPEFTTNSEGYLTIKLKSL
FT                   VGIKNIEVNLNITSPHGDVSKNAKLVDFEVSPQPAGLFMYREGKKDTINLFTKEQERPY
FT                   NAVGTLHNGELRTKDNKLLSNSENGKLVKVHDYEYDDPDGILSYNNKHDPNFAFENVGK
FT                   ATVKALVQTLNRDNEVVYERLYAYNFNILRLFTAIDQMNDPYVPGISNISCESDNKMGG
FT                   KTPKLSDVIGPKTLSDEFRNAFSWGLFHRVQLPHDIDKKDFAKFAIIDENAPPNNPYAP
FT                   YSIYDAVHGNIIDPTNSNVLLICLWKQGG"
     MRIDSINFKP LPIDFEIESI EVTNFTSQHS LPGDGNSAYE YRAKIINKTN GKKISNYSFD        60
     PKQVNWSREP KRSPKLVDEK DLVLFDPEFT TNSEGYLTIK LKSLVGIKNI EVNLNITSPH       120
     GDVSKNAKLV DFEVSPQPAG LFMYREGKKD TINLFTKEQE RPYNAVGTLH NGELRTKDNK       180
     LLSNSENGKL VKVHDYEYDD PDGILSYNNK HDPNFAFENV GKATVKALVQ TLNRDNEVVY       240
     ERLYAYNFNI LRLFTAIDQM NDPYVPGISN ISCESDNKMG GKTPKLSDVI GPKTLSDEFR       300
     NAFSWGLFHR VQLPHDIDKK DFAKFAIIDE NAPPNNPYAP YSIYDAVHGN IIDPTNSNVL       360
     LICLWKQGG                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page