(data stored in ACNUC1104 zone)

EMBL: FN667741.PE224

FN667741.PE224       Location/Qualifiers
FT   CDS             complement(226421..228232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0228"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0228"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79379"
FT                   /db_xref="GOA:D3UYK1"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYK1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79379.1"
FT                   /translation="MKWLGKFFVTLLLLLILAIIVIYIVVQTHWGTKQLNQWLNRQGHY
FT                   EISIDSISHNWLQPATLTLNNVNIHDKQSAFSLNVSTVNLDLKWQHLLTPRNLHRLTLQ
FT                   QGKLILAGDQLPPLLQADILQLNQMNIQLENPHTQIKGENITGGITPWMPAAGNPFGNG
FT                   QYQFSASTMSFNGIPFEKVIMQGSYQNKTLTIDTFGAAFLQGAISGDGRQLSDGSWRWN
FT                   NLLISNIRWQSPMTLSTLQEKTRHLPAIHVKDLNITNAKLQGKNWSVDYLDTTIKNLGL
FT                   VNGSWEAKDGLIDFNVMNMAFNNAQFSNTLGQLHFSGDTFTVAHLTTHYQKGLFNIQSE
FT                   WDRKNRQLTFNNSSVTGLVYDLPPTWRNDIKNAAPGWISGLTLNDISVNNTLLIDVNPD
FT                   FPFQLTTLSGHVDTMNILKNGRWGLWEGQASLQAASGTFNKIEITRPYLQLHATDDRLT
FT                   IDKLNAFNGHGLLQASGSAEQQTAQKPFELNFKGMNADLGILPRWGWIPLTMQGEGNFS
FT                   LALTGNLSADDIKGTINGTLTAEDKSSNKDSQSIVQGLILSSNCSPAGTVDGAAIAPST
FT                   EAHTAEAGNTRAESETAESKTCLKIKL"
     MKWLGKFFVT LLLLLILAII VIYIVVQTHW GTKQLNQWLN RQGHYEISID SISHNWLQPA        60
     TLTLNNVNIH DKQSAFSLNV STVNLDLKWQ HLLTPRNLHR LTLQQGKLIL AGDQLPPLLQ       120
     ADILQLNQMN IQLENPHTQI KGENITGGIT PWMPAAGNPF GNGQYQFSAS TMSFNGIPFE       180
     KVIMQGSYQN KTLTIDTFGA AFLQGAISGD GRQLSDGSWR WNNLLISNIR WQSPMTLSTL       240
     QEKTRHLPAI HVKDLNITNA KLQGKNWSVD YLDTTIKNLG LVNGSWEAKD GLIDFNVMNM       300
     AFNNAQFSNT LGQLHFSGDT FTVAHLTTHY QKGLFNIQSE WDRKNRQLTF NNSSVTGLVY       360
     DLPPTWRNDI KNAAPGWISG LTLNDISVNN TLLIDVNPDF PFQLTTLSGH VDTMNILKNG       420
     RWGLWEGQAS LQAASGTFNK IEITRPYLQL HATDDRLTID KLNAFNGHGL LQASGSAEQQ       480
     TAQKPFELNF KGMNADLGIL PRWGWIPLTM QGEGNFSLAL TGNLSADDIK GTINGTLTAE       540
     DKSSNKDSQS IVQGLILSSN CSPAGTVDGA AIAPSTEAHT AEAGNTRAES ETAESKTCLK       600
     IKL                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page