(data stored in ACNUC1104 zone)

EMBL: FN667741.PE232

FN667741.PE232       Location/Qualifiers
FT   CDS             237048..238907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0236"
FT                   /product="DNA ligase (modular protein)"
FT                   /EC_number="6.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0236"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79387"
FT                   /db_xref="GOA:D3UYK9"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR020923"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYK9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79387.1"
FT                   /translation="MLNFLIMILALLFGIPVALAGMAEQVPAEFTESVETGSTGNMADC
FT                   PVWPQEKIQREMQHLTRQMAEWDQLYRQQGISEIDDEFYDQLLEILTLWRTCLHQTSDS
FT                   TFSVAVPREGKQPHPVQHTGLNKLKGVKEIHQWLQGRSVVWLQPKVDGVAVTLVYEKGR
FT                   LVGLISRGNGSEGTNWMDKSSFITDIPKQIKNAPERLVLQGELFWQQDNHRQSVAGGQG
FT                   ARSKVAGLMMRKSSAPELGQIGIFIWGWPDGPNEMAVKLERLASMGFPTAQQYSHRIFS
FT                   AEDAEKRWSSYFIQPLPFATDGVVLRQETEPTGRQWRAGSNSWAIAWKYPLQQQLTTVR
FT                   DVNFKIGRTGRISVLLELEKVKLDDRQVRRVNLGSVSRWRQWNVYPGDKVTVALAGHGV
FT                   PKLDKVVWRIAERPDIQPPNAQDFHSLSCLVSHDSCQQQFIARLTWLGENLNMQGIGQG
FT                   TWAALVKHGLVTHLTDWLALDIAQLTEVPNIGIKRAELIFAQFQQARLQPLSSWREAIG
FT                   LPYANRFTDEMGWQQDLLLSKTGAKNSLTTKQTAKIAAFLQHPEIKTLVHALTVHGIGE
FT                   KQESEENTVGEKKEVESVSYSEAREQEHASDALNNVSAQNPHN"
     MLNFLIMILA LLFGIPVALA GMAEQVPAEF TESVETGSTG NMADCPVWPQ EKIQREMQHL        60
     TRQMAEWDQL YRQQGISEID DEFYDQLLEI LTLWRTCLHQ TSDSTFSVAV PREGKQPHPV       120
     QHTGLNKLKG VKEIHQWLQG RSVVWLQPKV DGVAVTLVYE KGRLVGLISR GNGSEGTNWM       180
     DKSSFITDIP KQIKNAPERL VLQGELFWQQ DNHRQSVAGG QGARSKVAGL MMRKSSAPEL       240
     GQIGIFIWGW PDGPNEMAVK LERLASMGFP TAQQYSHRIF SAEDAEKRWS SYFIQPLPFA       300
     TDGVVLRQET EPTGRQWRAG SNSWAIAWKY PLQQQLTTVR DVNFKIGRTG RISVLLELEK       360
     VKLDDRQVRR VNLGSVSRWR QWNVYPGDKV TVALAGHGVP KLDKVVWRIA ERPDIQPPNA       420
     QDFHSLSCLV SHDSCQQQFI ARLTWLGENL NMQGIGQGTW AALVKHGLVT HLTDWLALDI       480
     AQLTEVPNIG IKRAELIFAQ FQQARLQPLS SWREAIGLPY ANRFTDEMGW QQDLLLSKTG       540
     AKNSLTTKQT AKIAAFLQHP EIKTLVHALT VHGIGEKQES EENTVGEKKE VESVSYSEAR       600
     EQEHASDALN NVSAQNPHN                                                    619
//

If you have problems or comments...

PBIL Back to PBIL home page