(data stored in ACNUC1104 zone)

EMBL: FN667741.PE234

FN667741.PE234       Location/Qualifiers
FT   CDS             239639..240940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0238"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79389"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR022223"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYL1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79389.1"
FT                   /translation="MVFKERQITFDNRSHQITNINIWTPDSQWLVYDVRPSGASFTGLT
FT                   IEKIHVGSRQVKVIYQAQDDAHVGVVTVNPQEPVRYAFIHGPEKPDTQWQYDFHHRRGV
FT                   IVSDAQPNVAVNIEALDITPPYTSGALRGGTHVHVFSPDGNRLSFTYNDHVMHERDPAL
FT                   DLRNVAVAIPLRAVIPPKKHPREYDGSYFSVIVSRTTPQPRSGSDEINRAYEEGWIGQR
FT                   GYPKENGQWQRWALAFIGDTCAENGEKIPEIYLVDLPDNNEDYAIEGKQPLAGTETTLP
FT                   APPAGVKQRRLTFTHQNRWPGVVNVPRHWLRTSPDGSKIGFLMKDEAGIVQLWYISPNG
FT                   GVPVQITHSTHHIQSAFNWDRRGRFIAFVCDNSIMLCDSQNGEMHRLTARTDDAPSADA
FT                   IVISPDDRYVAFMRDIDGYRQILVVETGITDVGE"
     MVFKERQITF DNRSHQITNI NIWTPDSQWL VYDVRPSGAS FTGLTIEKIH VGSRQVKVIY        60
     QAQDDAHVGV VTVNPQEPVR YAFIHGPEKP DTQWQYDFHH RRGVIVSDAQ PNVAVNIEAL       120
     DITPPYTSGA LRGGTHVHVF SPDGNRLSFT YNDHVMHERD PALDLRNVAV AIPLRAVIPP       180
     KKHPREYDGS YFSVIVSRTT PQPRSGSDEI NRAYEEGWIG QRGYPKENGQ WQRWALAFIG       240
     DTCAENGEKI PEIYLVDLPD NNEDYAIEGK QPLAGTETTL PAPPAGVKQR RLTFTHQNRW       300
     PGVVNVPRHW LRTSPDGSKI GFLMKDEAGI VQLWYISPNG GVPVQITHST HHIQSAFNWD       360
     RRGRFIAFVC DNSIMLCDSQ NGEMHRLTAR TDDAPSADAI VISPDDRYVA FMRDIDGYRQ       420
     ILVVETGITD VGE                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page