(data stored in ACNUC1104 zone)

EMBL: FN667741.PE247

FN667741.PE247       Location/Qualifiers
FT   CDS             255249..255956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0251"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0251"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79402"
FT                   /db_xref="GOA:D3UYM4"
FT                   /db_xref="InterPro:IPR033419"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYM4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79402.1"
FT                   /translation="MKLRVKRSLTIKQMAAVTGVALITIAIFITIQLSHLLQQRKDDYI
FT                   SQLNNAAAQVQVPLAEALLNSDLNKAKTLLIGLKTSGILGRADVVSPNNARVMSLDFAT
FT                   YRPIPELAKQIFGIPVEVQIPLHIYGITPQTEASQGYLILQVDSNRVYRFALNTLALML
FT                   TTYLLLALILTVAISWCVNRIIIHPLRDVARALNEEQPTAPILCPKNHQDDELGLLVKG
FT                   YNRQIDKQKLRLK"
     MKLRVKRSLT IKQMAAVTGV ALITIAIFIT IQLSHLLQQR KDDYISQLNN AAAQVQVPLA        60
     EALLNSDLNK AKTLLIGLKT SGILGRADVV SPNNARVMSL DFATYRPIPE LAKQIFGIPV       120
     EVQIPLHIYG ITPQTEASQG YLILQVDSNR VYRFALNTLA LMLTTYLLLA LILTVAISWC       180
     VNRIIIHPLR DVARALNEEQ PTAPILCPKN HQDDELGLLV KGYNRQIDKQ KLRLK            235
//

If you have problems or comments...

PBIL Back to PBIL home page