(data stored in ACNUC1104 zone)

EMBL: FN667741.PE260

FN667741.PE260       Location/Qualifiers
FT   CDS             270579..272057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /locus_tag="XBJ1_0264"
FT                   /product="conserved hypothetical protein (probable
FT                   component of the SST VI cluster)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0264"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79415"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYN7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79415.1"
FT                   /translation="MAQHEENSTALASGATTSLLDEIMSQARITPENDGYYIAKQGIAA
FT                   FISSILDTGANEEPINKLVVDKMIVELDKKLSEQMDEIMHAKPFQELESSWRSLKILVD
FT                   RTDFRENIKINIIHATKDEMLEDFEFSPEIIQSGFYKHVYSTGYGQFGGEPVAAVIGNY
FT                   AFTNSSPDIKLMQYVSAVGAMAHSPFLSSVSPEFFGVNSFTDLPAIKDLKSVFEGPSHT
FT                   KWRALRESEDSRYLGLTAPRFLLRLPYSSVENPIKNFNYQENVSRDHEHFLWGNTAYLM
FT                   ASCLTDSFAKYRWCPNIIGPQSGGTVSDLPVHLYEAMGQVQAKIPTEVLITDRREFELA
FT                   EEGFITLTMRKGSDNAAFFSANSVQKPKVFPNTREGKIAETNYKLGTQLPYMFIINRLA
FT                   HYIKVLQREQIGSWKERQDLERELNMWLKQYIADQENPPTDVRSRRPLRAAEIKVLDVE
FT                   GDPGWYQVAMQVRPHFKYMGASFELSLVGRLDKE"
     MAQHEENSTA LASGATTSLL DEIMSQARIT PENDGYYIAK QGIAAFISSI LDTGANEEPI        60
     NKLVVDKMIV ELDKKLSEQM DEIMHAKPFQ ELESSWRSLK ILVDRTDFRE NIKINIIHAT       120
     KDEMLEDFEF SPEIIQSGFY KHVYSTGYGQ FGGEPVAAVI GNYAFTNSSP DIKLMQYVSA       180
     VGAMAHSPFL SSVSPEFFGV NSFTDLPAIK DLKSVFEGPS HTKWRALRES EDSRYLGLTA       240
     PRFLLRLPYS SVENPIKNFN YQENVSRDHE HFLWGNTAYL MASCLTDSFA KYRWCPNIIG       300
     PQSGGTVSDL PVHLYEAMGQ VQAKIPTEVL ITDRREFELA EEGFITLTMR KGSDNAAFFS       360
     ANSVQKPKVF PNTREGKIAE TNYKLGTQLP YMFIINRLAH YIKVLQREQI GSWKERQDLE       420
     RELNMWLKQY IADQENPPTD VRSRRPLRAA EIKVLDVEGD PGWYQVAMQV RPHFKYMGAS       480
     FELSLVGRLD KE                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page