(data stored in ACNUC1104 zone)

EMBL: FN667741.PE261

FN667741.PE261       Location/Qualifiers
FT   CDS             272060..272500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /locus_tag="XBJ1_0265"
FT                   /product="conserved hypothetical protein (probable
FT                   component of the SST VI cluster; lysozyme-related protein)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0265"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79416"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYN8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79416.1"
FT                   /translation="MAALYSWNRGSSASLFERIQGKGSGSSRQSRMRSLLDSIKKHLKE
FT                   VLNSRPGACQSAIDLGVIDLNDATATSVDFKQSIEWAIEECIRNYEPRISAVSVSAIND
FT                   DSDPLLLSFHISAEILLDDINDIVEFSIQLDNNRRYCLERTQ"
     MAALYSWNRG SSASLFERIQ GKGSGSSRQS RMRSLLDSIK KHLKEVLNSR PGACQSAIDL        60
     GVIDLNDATA TSVDFKQSIE WAIEECIRNY EPRISAVSVS AINDDSDPLL LSFHISAEIL       120
     LDDINDIVEF SIQLDNNRRY CLERTQ                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page