(data stored in ACNUC1104 zone)

EMBL: FN667741.PE262

FN667741.PE262       Location/Qualifiers
FT   CDS             272501..274333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /locus_tag="XBJ1_0266"
FT                   /product="conserved hypothetical protein (probable
FT                   component of the SST VI cluster)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0266"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79417"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYN9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79417.1"
FT                   /translation="MSFEKYFRDELNYLRQLGKEAAVERPHLAAFLSEQGSDPDVERLL
FT                   EGFAFLTGNLRAKIDDQFPELTHGLLNMLWPNYLRPTPSMTIIEYTPDESVVTKATPVK
FT                   RGTQIMSNTLSTHDDIYSNEKSGGKRDEQGRCTFTLCRDVWLFPLSIQDISVNNSNEQG
FT                   IIGLNFASKTELSLHELELDKLRFYLSGDDYTTSQLYFWLCYYFRKAELVVGDKVIPLP
FT                   DFDFVPVGFEREDALLPYPKNAYMGYRILQEYFCFAESFLFFDVKGFPTLPEDLKTKDF
FT                   KLNLHFSQALPPEAKIRHDTFRLHCTPAINLFPMDSEAIELNGSQAEYPLKASYSLPDN
FT                   YDIFSVDGVESWLAGENGERSRARIGERVYTPFESFNHQIDDEDERSMRYYRLRVKESP
FT                   FRRGLEHFISFVRGDESDLLRLKLKENVSISLTCTNRELPLQLRVGDINYPSIGSPTFA
FT                   TFRNITRPSVPLYPLLDGGLHWSLLSNMSLNYMSLLDKDALKQVLRTYDFPSIHNRQSK
FT                   RSSQKRLDAIEKIETEPTDRLFRGQPVRGLRSTLYIRQQAFSSEGELYLFSTILSRFFS
FT                   LYASVNAFHMLKVINLDNQECYEWPVQIGQHSLM"
     MSFEKYFRDE LNYLRQLGKE AAVERPHLAA FLSEQGSDPD VERLLEGFAF LTGNLRAKID        60
     DQFPELTHGL LNMLWPNYLR PTPSMTIIEY TPDESVVTKA TPVKRGTQIM SNTLSTHDDI       120
     YSNEKSGGKR DEQGRCTFTL CRDVWLFPLS IQDISVNNSN EQGIIGLNFA SKTELSLHEL       180
     ELDKLRFYLS GDDYTTSQLY FWLCYYFRKA ELVVGDKVIP LPDFDFVPVG FEREDALLPY       240
     PKNAYMGYRI LQEYFCFAES FLFFDVKGFP TLPEDLKTKD FKLNLHFSQA LPPEAKIRHD       300
     TFRLHCTPAI NLFPMDSEAI ELNGSQAEYP LKASYSLPDN YDIFSVDGVE SWLAGENGER       360
     SRARIGERVY TPFESFNHQI DDEDERSMRY YRLRVKESPF RRGLEHFISF VRGDESDLLR       420
     LKLKENVSIS LTCTNRELPL QLRVGDINYP SIGSPTFATF RNITRPSVPL YPLLDGGLHW       480
     SLLSNMSLNY MSLLDKDALK QVLRTYDFPS IHNRQSKRSS QKRLDAIEKI ETEPTDRLFR       540
     GQPVRGLRST LYIRQQAFSS EGELYLFSTI LSRFFSLYAS VNAFHMLKVI NLDNQECYEW       600
     PVQIGQHSLM                                                              610
//

If you have problems or comments...

PBIL Back to PBIL home page