(data stored in ACNUC1104 zone)

EMBL: FN667741.PE269

FN667741.PE269       Location/Qualifiers
FT   CDS             282037..282831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /locus_tag="XBJ1_0273"
FT                   /product="conserved hypothetical protein (probable
FT                   component of the SST VI cluster)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0273"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79424"
FT                   /db_xref="GOA:D3UYP6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYP6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79424.1"
FT                   /translation="MKQRLKSALALLDDDTIEQLVDHFLLVSQSSRFDALLVFLLNTNE
FT                   NRLECYNLPELHQASSRRLNVDIDDVNNPLIQVLRKGTPTVWDSLNHGARIDDVHFRTF
FT                   VAELPHNCGLYAIPLFDCNGQACGVIAIFAEHVSHFINNENMFGLYCHVMQHRLKKLQE
FT                   LEQLRGQLRQIRQVFQVQQQKEKQLDELLASLSGSKPAGVSRISVDYSHIDNLPKAIEE
FT                   FESAVLVQRQRQYGNDTRLIAQSLGIATRTLVYKLAKYGCRL"
     MKQRLKSALA LLDDDTIEQL VDHFLLVSQS SRFDALLVFL LNTNENRLEC YNLPELHQAS        60
     SRRLNVDIDD VNNPLIQVLR KGTPTVWDSL NHGARIDDVH FRTFVAELPH NCGLYAIPLF       120
     DCNGQACGVI AIFAEHVSHF INNENMFGLY CHVMQHRLKK LQELEQLRGQ LRQIRQVFQV       180
     QQQKEKQLDE LLASLSGSKP AGVSRISVDY SHIDNLPKAI EEFESAVLVQ RQRQYGNDTR       240
     LIAQSLGIAT RTLVYKLAKY GCRL                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page