(data stored in ACNUC1104 zone)

EMBL: FN667741.PE270

FN667741.PE270       Location/Qualifiers
FT   CDS             282828..283493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /locus_tag="XBJ1_0274"
FT                   /product="conserved hypothetical protein (probable
FT                   component of the SST VI cluster)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0274"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79425"
FT                   /db_xref="InterPro:IPR017738"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYP7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79425.1"
FT                   /translation="MNIVLIISSLLASLTGDPKLANLVEPKEVVAPKEEYTDEMQKCRF
FT                   EPSPLVRLACYDRTVNNLKFNALQIPMENMGLVWRQAMEQEMKRTDYSTGFIVTQGENG
FT                   EAPVILTTPAVGVPPPRPVLMLSCIDRITRLQVALPKPMGSGTVTVTTDKTQFKTEWFL
FT                   REHGYLWESSRGLPGIEEIKRLMNSDQMTITARTGSPITFNISQLEQAAKPLRDACRW"
     MNIVLIISSL LASLTGDPKL ANLVEPKEVV APKEEYTDEM QKCRFEPSPL VRLACYDRTV        60
     NNLKFNALQI PMENMGLVWR QAMEQEMKRT DYSTGFIVTQ GENGEAPVIL TTPAVGVPPP       120
     RPVLMLSCID RITRLQVALP KPMGSGTVTV TTDKTQFKTE WFLREHGYLW ESSRGLPGIE       180
     EIKRLMNSDQ MTITARTGSP ITFNISQLEQ AAKPLRDACR W                           221
//

If you have problems or comments...

PBIL Back to PBIL home page