(data stored in ACNUC1104 zone)

EMBL: FN667741.PE271

FN667741.PE271       Location/Qualifiers
FT   CDS             283499..284935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /locus_tag="XBJ1_0275"
FT                   /product="Conserved hypothetical protein with ImpA
FT                   domain(probable component of SST VI cluster)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0275"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79426"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017739"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYP8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79426.1"
FT                   /translation="MDIRTQFDWFGALLAPLSDEQTGKALSESDPAWEFIDGEMVKFGS
FT                   LSHGTLEVDALQRQALQLFSEHSKDFRLMVHLLRTLQHAGHPAELILAIELLTEYVKNY
FT                   WEKAWPVKPVLKRRLAQQVIKRFESAQSSFTDQASKSQRDEAQGALAHLAQCWHASEPD
FT                   LAKDVDQLRTRYNRQPEARTAPTQTAPTTPEAASVAPSPQSPEQAPMPEVAVNSSSDKA
FT                   WKQTLMTVADLLCERYPESPIGYSLRRHAVWHTITTAPMANATGKTPLAPASADRTADY
FT                   LARLPTADNKLLAQIEQSLALAPYWLDGHAIAAQAAEQRGYSRVAQAMRDELKAFLARL
FT                   PVLKTLSFSDLSPFISPDTLDWLTPEPDTSGSPGAASADQEAIWHCFQQQGLEAALQML
FT                   EEHQQSLTEPRDQFYGQLFTAQLLEEAGMTALAHQHYRNLLHTGQHMLLTEWEPSLLTL
FT                   LAEKIPSPAKDTASHRSVNT"
     MDIRTQFDWF GALLAPLSDE QTGKALSESD PAWEFIDGEM VKFGSLSHGT LEVDALQRQA        60
     LQLFSEHSKD FRLMVHLLRT LQHAGHPAEL ILAIELLTEY VKNYWEKAWP VKPVLKRRLA       120
     QQVIKRFESA QSSFTDQASK SQRDEAQGAL AHLAQCWHAS EPDLAKDVDQ LRTRYNRQPE       180
     ARTAPTQTAP TTPEAASVAP SPQSPEQAPM PEVAVNSSSD KAWKQTLMTV ADLLCERYPE       240
     SPIGYSLRRH AVWHTITTAP MANATGKTPL APASADRTAD YLARLPTADN KLLAQIEQSL       300
     ALAPYWLDGH AIAAQAAEQR GYSRVAQAMR DELKAFLARL PVLKTLSFSD LSPFISPDTL       360
     DWLTPEPDTS GSPGAASADQ EAIWHCFQQQ GLEAALQMLE EHQQSLTEPR DQFYGQLFTA       420
     QLLEEAGMTA LAHQHYRNLL HTGQHMLLTE WEPSLLTLLA EKIPSPAKDT ASHRSVNT         478
//

If you have problems or comments...

PBIL Back to PBIL home page