(data stored in ACNUC1104 zone)

EMBL: FN667741.PE275

FN667741.PE275       Location/Qualifiers
FT   CDS             293056..293421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0055"
FT                   /locus_tag="XBJ1_0279"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0279"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79430"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYQ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79430.1"
FT                   /translation="MVKKSLLSFLGVMLLACSSMLFAAYTDVFETKTYHITINVLCPEG
FT                   NVSCDNVIYTGVRKKDNASITLKGTTLNKDCNTGTCDFYGYEFKNKDVTYTIYQYGSLE
FT                   ISKKGEVIFSEDRISKE"
     MVKKSLLSFL GVMLLACSSM LFAAYTDVFE TKTYHITINV LCPEGNVSCD NVIYTGVRKK        60
     DNASITLKGT TLNKDCNTGT CDFYGYEFKN KDVTYTIYQY GSLEISKKGE VIFSEDRISK       120
     E                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page