(data stored in ACNUC1104 zone)

EMBL: FN667741.PE278

FN667741.PE278       Location/Qualifiers
FT   CDS             298712..299164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0056"
FT                   /locus_tag="XBJ1_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0282"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79433"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYQ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79433.1"
FT                   /translation="MITIFIMNSKLEEKMLLARAKRYINNIQGIEKISISLSNNDKEFQ
FT                   WHKEIINSILKGKEIPECKLELPVSEEDIYSYLQSKIHIGECNSYYMFFEGMVKFSFNI
FT                   IDLKRFLSSCYALKKTFDLYVLLLNPMKVIAISEEEYELSFYNKTM"
     MITIFIMNSK LEEKMLLARA KRYINNIQGI EKISISLSNN DKEFQWHKEI INSILKGKEI        60
     PECKLELPVS EEDIYSYLQS KIHIGECNSY YMFFEGMVKF SFNIIDLKRF LSSCYALKKT       120
     FDLYVLLLNP MKVIAISEEE YELSFYNKTM                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page