(data stored in ACNUC1104 zone)

EMBL: FN667741.PE279

FN667741.PE279       Location/Qualifiers
FT   CDS             complement(299238..299435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0057"
FT                   /locus_tag="XBJ1_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0283"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79434"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYQ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79434.1"
FT                   /translation="MTLTVDAYGEPDIVFGHFDIFQCLAAMFCRFDFPLVLVQQRDTLD
FT                   QGEIFHVVTAGTGLGDDKSN"
     MTLTVDAYGE PDIVFGHFDI FQCLAAMFCR FDFPLVLVQQ RDTLDQGEIF HVVTAGTGLG        60
     DDKSN                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page