(data stored in ACNUC1104 zone)

EMBL: FN667741.PE281

FN667741.PE281       Location/Qualifiers
FT   CDS             complement(300206..300508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0285"
FT                   /product="Insertion element iso-IS1n protein insB
FT                   (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0285"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79436"
FT                   /db_xref="GOA:D3UWL6"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWL6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79436.1"
FT                   /translation="MKRIVAHVFGDRSRKTLDKLLTLLSSFTIRFYCTDDYVVYDPLPE
FT                   EEHLTGKAFTQRIERTNLTHRTRIKRLNRKTIGYSKSEEMHDKVIGTFIEREHYF"
     MKRIVAHVFG DRSRKTLDKL LTLLSSFTIR FYCTDDYVVY DPLPEEEHLT GKAFTQRIER        60
     TNLTHRTRIK RLNRKTIGYS KSEEMHDKVI GTFIEREHYF                             100
//

If you have problems or comments...

PBIL Back to PBIL home page