(data stored in ACNUC1104 zone)

EMBL: FN667741.PE285

FN667741.PE285       Location/Qualifiers
FT   CDS             complement(302157..302504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0058"
FT                   /locus_tag="XBJ1_0289"
FT                   /product="putative Transposase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0289"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79440"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWS5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79440.1"
FT                   /translation="MMEKTHMSQSRFTQAEWRDLFEQQKKSELTVPQFCQKIGVSTTRF
FT                   YHHRQRTSHPPEKPSGLASPSAFIKVSTAQKKSASSSILPILFETPHGTLRFPAGTDKH
FT                   VIIAIIRGLAA"
     MMEKTHMSQS RFTQAEWRDL FEQQKKSELT VPQFCQKIGV STTRFYHHRQ RTSHPPEKPS        60
     GLASPSAFIK VSTAQKKSAS SSILPILFET PHGTLRFPAG TDKHVIIAII RGLAA            115
//

If you have problems or comments...

PBIL Back to PBIL home page