(data stored in ACNUC1104 zone)

EMBL: FN667741.PE288

FN667741.PE288       Location/Qualifiers
FT   CDS             303397..304467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0060"
FT                   /locus_tag="XBJ1_0292"
FT                   /product="Rhs-like core protein (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0292"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79443"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYR5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79443.1"
FT                   /translation="MTQSQQAGRVIRRGDVSYRYDDSGRLVEKTVQRDGFRPQVWRYRW
FT                   DALNQLTQCETPDGSRWYYQYDAFGRRIRKLKVHDGKLAAANLQRWLDGKPDLTPKPRT
FT                   MMGQDYLWSGDQLIEETPLYADGTPAEDQRIRWLYEPGKLTPSARYERGKLHYIVSDHQ
FT                   GTPREMLNEEGGLVWAQRLTTWGKAEKSQVIASNDPDYHVGCHFRFMGQYEDEESGLYY
FT                   NRFRYYDRETGQYLTPDPIGLLGGLNPYGYVDNPVNFIDPFGLAKCHLDNPKKKVNSAD
FT                   VGDFVRTPTSHPDDFTKIKGGNYKNKNTNEIWSKSNTTHSDKEGEWKVGIGKAEPKPRH
FT                   KITIGMSDGKIIKIDK"
     MTQSQQAGRV IRRGDVSYRY DDSGRLVEKT VQRDGFRPQV WRYRWDALNQ LTQCETPDGS        60
     RWYYQYDAFG RRIRKLKVHD GKLAAANLQR WLDGKPDLTP KPRTMMGQDY LWSGDQLIEE       120
     TPLYADGTPA EDQRIRWLYE PGKLTPSARY ERGKLHYIVS DHQGTPREML NEEGGLVWAQ       180
     RLTTWGKAEK SQVIASNDPD YHVGCHFRFM GQYEDEESGL YYNRFRYYDR ETGQYLTPDP       240
     IGLLGGLNPY GYVDNPVNFI DPFGLAKCHL DNPKKKVNSA DVGDFVRTPT SHPDDFTKIK       300
     GGNYKNKNTN EIWSKSNTTH SDKEGEWKVG IGKAEPKPRH KITIGMSDGK IIKIDK           356
//

If you have problems or comments...

PBIL Back to PBIL home page