(data stored in ACNUC1104 zone)

EMBL: FN667741.PE294

FN667741.PE294       Location/Qualifiers
FT   CDS             306437..307033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0298"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79449"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYS1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79449.1"
FT                   /translation="MQSSVKVKKEDTITISYYINGICAFEFNGHIIDKENTLTNSQGFS
FT                   FVIKTSDEPPLTIIAILKEWVKGNDFIYWKNNKCIEAKNLWLTACLYWQQIFPPKPNKI
FT                   LNASLSLEGINNYLDFFCMLGEAFWGKRGYIGRDFHGFDDLLGDLSYEKSEINIYIENM
FT                   NKLKLFLERISPPDYNYHEIFMGILVNRKCNINKK"
     MQSSVKVKKE DTITISYYIN GICAFEFNGH IIDKENTLTN SQGFSFVIKT SDEPPLTIIA        60
     ILKEWVKGND FIYWKNNKCI EAKNLWLTAC LYWQQIFPPK PNKILNASLS LEGINNYLDF       120
     FCMLGEAFWG KRGYIGRDFH GFDDLLGDLS YEKSEINIYI ENMNKLKLFL ERISPPDYNY       180
     HEIFMGILVN RKCNINKK                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page