(data stored in ACNUC1104 zone)

EMBL: FN667741.PE295

FN667741.PE295       Location/Qualifiers
FT   CDS             307304..307579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0061"
FT                   /locus_tag="XBJ1_0299"
FT                   /product="Insertion element iso-IS1N protein insA"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0299"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79450"
FT                   /db_xref="InterPro:IPR024431"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYS2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79450.1"
FT                   /translation="MAKVEVDCRYCHQSEDVKGQGKGHRGYPRYRCYACSKVFQLAYTY
FT                   QACKPGVKEQTIDMAMNNSGIRDTARVLKVATATVMKTLKNSTPGT"
     MAKVEVDCRY CHQSEDVKGQ GKGHRGYPRY RCYACSKVFQ LAYTYQACKP GVKEQTIDMA        60
     MNNSGIRDTA RVLKVATATV MKTLKNSTPG T                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page