(data stored in ACNUC1104 zone)

EMBL: FN667741.PE303

FN667741.PE303       Location/Qualifiers
FT   CDS             310557..310709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0308"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79458"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYT0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79458.1"
FT                   /translation="MKVCKPQKKGPKGPFYVPVIMTKIHSHPALFSRSLITPGLRLPEP
FT                   FGYLG"
     MKVCKPQKKG PKGPFYVPVI MTKIHSHPAL FSRSLITPGL RLPEPFGYLG                   50
//

If you have problems or comments...

PBIL Back to PBIL home page