(data stored in ACNUC1104 zone)

EMBL: FN667741.PE307

FN667741.PE307       Location/Qualifiers
FT   CDS             complement(320206..323574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0312"
FT                   /product="putative oxyreductase protein"
FT                   /EC_number="1.2.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0312"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79462"
FT                   /db_xref="GOA:D3UYT4"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYT4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79462.1"
FT                   /translation="MTQHYPSKFVTGTDALAELLLAQAELDKSHNLNTAGFVAGYRGSP
FT                   LARLDQALWQHGKELAQSNIRFQPAINEDLAATALIGTQKVESDPDRNVIGVFGMWYGK
FT                   GPGVDRSGDALRHGNAYGSSPHGGVLVILGDDHGCVSSSMSHQSDLVLMAWSMPILHPA
FT                   SVSDYHDVGLWGWAASRASGAWVGFKAISEVVESSAIRKSKPFPEYKTPEIDSGPDGLH
FT                   WRWPDLPGPQIEKRLAYKLKAVEAFARANPIDQLLAPCAHPRALLVTVGKAHRDVLEAL
FT                   RAGGLTPSQLAKQGVAFVHVRLVYPLSPLLSDLASQVTDIFVIEEKNAVVEILLARHLV
FT                   NSQKNIKLIGKHNHLGQQFLPADIELRPSLITPLLSGWLNKLDLFLSVPLEWATKTTPH
FT                   DLTLPKRTPYFCAGCPHSTSTRLPEGSQAQIGIGCHVMAAWMDRNTGFGLVQMGGEGAD
FT                   WVGHSPFINRPHLFQNLGDGTYFHSGHLSIRQSIAAGNHITYKLLFNQAVAMTGGQPLD
FT                   GNLTIPQIVALMLAEGVKEVAIVTDDIDKYQDKNLLTAKVTLYQRDYLEEVQKRFREIA
FT                   GVTVIIYDQACATELRRKRKRGLEPKATRRAVINELVCEGCGDCQVQSNCLAVIPVKTS
FT                   LGTKRKIDQHVCNSDLSCLKGFCPSFVTVENANPRHDLSKIIPQGDLDKLLRELPQPIL
FT                   IISDNPYEILLVGVGGTGIVTAGNLLAIAAEADNYSVSLLNFTGFAQKGGEAITHVRLC
FT                   HDMNKLHQVRIDRGRANLIIAADLVAATGQNSLTVMSKSATKCVLNTHETQIGTMLRAP
FT                   TLNLDHPKMMTTLHQHCQTLNSIDAEIMAADLVGDRNQTNIVLIGYAWQLGKIPITLSA
FT                   IDHTIQALGNAADSARRAFHIGRIAAVQPDILNERLHIKPQESIKTLDDLIMHRYQFLV
FT                   DYQNEGYAQRYLSRVAQIQLVTQQIDAEEIAKAVAENLFKLMAYKDEYEVARLYAKSDF
FT                   FENLRSQFDNTDNIRFHFSLPLFNRKDPRTGERGKREYGTWIIPIFRVLAACKPLRGTM
FT                   FDIFGYQEERRQERNLLLEYERLLDFLIEKLNRDNLAICQQLAELPDQVRGFGHVKQKA
FT                   IKNMMERKEALLEKL"
     MTQHYPSKFV TGTDALAELL LAQAELDKSH NLNTAGFVAG YRGSPLARLD QALWQHGKEL        60
     AQSNIRFQPA INEDLAATAL IGTQKVESDP DRNVIGVFGM WYGKGPGVDR SGDALRHGNA       120
     YGSSPHGGVL VILGDDHGCV SSSMSHQSDL VLMAWSMPIL HPASVSDYHD VGLWGWAASR       180
     ASGAWVGFKA ISEVVESSAI RKSKPFPEYK TPEIDSGPDG LHWRWPDLPG PQIEKRLAYK       240
     LKAVEAFARA NPIDQLLAPC AHPRALLVTV GKAHRDVLEA LRAGGLTPSQ LAKQGVAFVH       300
     VRLVYPLSPL LSDLASQVTD IFVIEEKNAV VEILLARHLV NSQKNIKLIG KHNHLGQQFL       360
     PADIELRPSL ITPLLSGWLN KLDLFLSVPL EWATKTTPHD LTLPKRTPYF CAGCPHSTST       420
     RLPEGSQAQI GIGCHVMAAW MDRNTGFGLV QMGGEGADWV GHSPFINRPH LFQNLGDGTY       480
     FHSGHLSIRQ SIAAGNHITY KLLFNQAVAM TGGQPLDGNL TIPQIVALML AEGVKEVAIV       540
     TDDIDKYQDK NLLTAKVTLY QRDYLEEVQK RFREIAGVTV IIYDQACATE LRRKRKRGLE       600
     PKATRRAVIN ELVCEGCGDC QVQSNCLAVI PVKTSLGTKR KIDQHVCNSD LSCLKGFCPS       660
     FVTVENANPR HDLSKIIPQG DLDKLLRELP QPILIISDNP YEILLVGVGG TGIVTAGNLL       720
     AIAAEADNYS VSLLNFTGFA QKGGEAITHV RLCHDMNKLH QVRIDRGRAN LIIAADLVAA       780
     TGQNSLTVMS KSATKCVLNT HETQIGTMLR APTLNLDHPK MMTTLHQHCQ TLNSIDAEIM       840
     AADLVGDRNQ TNIVLIGYAW QLGKIPITLS AIDHTIQALG NAADSARRAF HIGRIAAVQP       900
     DILNERLHIK PQESIKTLDD LIMHRYQFLV DYQNEGYAQR YLSRVAQIQL VTQQIDAEEI       960
     AKAVAENLFK LMAYKDEYEV ARLYAKSDFF ENLRSQFDNT DNIRFHFSLP LFNRKDPRTG      1020
     ERGKREYGTW IIPIFRVLAA CKPLRGTMFD IFGYQEERRQ ERNLLLEYER LLDFLIEKLN      1080
     RDNLAICQQL AELPDQVRGF GHVKQKAIKN MMERKEALLE KL                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page