(data stored in ACNUC1104 zone)

EMBL: FN667741.PE308

FN667741.PE308       Location/Qualifiers
FT   CDS             324038..324223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0313"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79463"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYT5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79463.1"
FT                   /translation="MTHISYLNKVHRNLITINPAKISSYLMIPSYYLASQACRKSANYS
FT                   GADGLGLITSLIFMKS"
     MTHISYLNKV HRNLITINPA KISSYLMIPS YYLASQACRK SANYSGADGL GLITSLIFMK        60
     S                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page