(data stored in ACNUC1104 zone)

EMBL: FN667741.PE310

FN667741.PE310       Location/Qualifiers
FT   CDS             324385..324576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0315"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0315"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79465"
FT                   /db_xref="GOA:D3UYT7"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYT7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79465.1"
FT                   /translation="MFAYGLAGIAGNFLSGSAATKQLRWTLVFITIGITAAVLLFSPLG
FT                   GSIAGSNYLIRTIYHYHK"
     MFAYGLAGIA GNFLSGSAAT KQLRWTLVFI TIGITAAVLL FSPLGGSIAG SNYLIRTIYH        60
     YHK                                                                      63
//

If you have problems or comments...

PBIL Back to PBIL home page