(data stored in ACNUC1104 zone)

EMBL: FN667741.PE337

FN667741.PE337       Location/Qualifiers
FT   CDS             349583..353326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0069"
FT                   /locus_tag="XBJ1_0342"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0342"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79492"
FT                   /db_xref="GOA:D3UYW4"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYW4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79492.1"
FT                   /translation="MTFLLLVGLLLITIVGLVGTQTGLHFMINSAARWVPGLDIANVSG
FT                   GWRDLTLKGVKYQMPGVSVSADNLYLSLRLSCLKHSHLCVNALTTEGVAVSVNTADLPP
FT                   SEKSPASEPLTELKTPYPISLDLLSLKNIHVKVDDIVIALDEFKTGAQWREKQLTLKPT
FT                   KISNLLVALPKTRPEQSGTVQKGKQKPEPEKSLGETLKALFAKPFLAELPNVPIPLDIM
FT                   AENIHGSQLRLTGDTDITINDLRLQASNQGQQVDVKTFSVSAPEGSLSLQGTAGLSEQW
FT                   PVKLVIKSNTNLNELKGQKLDLTLNGALLQQLNLALHLSGPIIANLSAQTELAKAGLPV
FT                   RLTLESKQLQWPLTGEPEYRLDGVKLRLNGKASGYDLSLRSDIKGRDIPPALLMLDAKG
FT                   NEELLRLTRLRLSALQGKAEITGIVDWSKAISWNANLILDGINTAKQWPEWPAKMNGKM
FT                   AIRGSLYGGSWQLQIPEIALDGYVKQNIVKAHGKASGNAAGQWNIPQFDLTFGRNRLNV
FT                   QGQLTDEKWKLDGEINAPQLNGLLPGLSGVVIGNVKLRGNMKAPQIVADLNARNVRWQN
FT                   DLKVDSATIKGDVRSAEQIEGQLSVAVHQLKQADLIINNLMLNAKGTEKQHDLHLNIEG
FT                   NPVSGQLALSGRFDRSQERWQGTINNTYFDTPVGEWRLNKAMVIDYLNPQQKVTIGTHC
FT                   WLNPNAQICVPKPIEAGASGHAEVVLKRFDLAMIQPFLDKMTQVKGVFSGNANVKWTAG
FT                   QALPQAKVVLQGNGVQLHQMVEGAALPVDFETLTVNAGLTNGKANVAWLFKLAGNGQLN
FT                   GNVQVDDLEGRRKLSGNVDIRALSLKLIKPILGKDEKAEGGLNANLRFGGNVKNPLLFG
FT                   QLKTDDLQIVSHWLPFDITQGQLAIYFDGVRSGLEGVIKTPKGQLNLNGNADWRNLNAW
FT                   YAKIAANGEKLRVTVPPMVKIDVSPNLVLEATPDLLKLDGNVDIPWARITVQELPESAV
FT                   GISSDEVMLDKNLQPIEKKKSSILVKSNLNIRIGDDVRLNAFGLKAQLKGVLKVIQDKQ
FT                   GLGLNGQIDIPDGRFHAYGQDLLVRKGTIIFSGPPEQPMLNIEAIRNPDSTANKVVAGV
FT                   KVTGLADKPKVEIFSEPAKSQQEALSYLLRGEGLEKSGSDNNQMTSMLIGLGVSQSGQL
FT                   VGKIGETFGVSDLALDTQGVGDKSQVVVSGKITNNLQVKYGVGIFDSLATLTLRYRVMP
FT                   RLYLDAVSGIDQALDLLYEFEF"
     MTFLLLVGLL LITIVGLVGT QTGLHFMINS AARWVPGLDI ANVSGGWRDL TLKGVKYQMP        60
     GVSVSADNLY LSLRLSCLKH SHLCVNALTT EGVAVSVNTA DLPPSEKSPA SEPLTELKTP       120
     YPISLDLLSL KNIHVKVDDI VIALDEFKTG AQWREKQLTL KPTKISNLLV ALPKTRPEQS       180
     GTVQKGKQKP EPEKSLGETL KALFAKPFLA ELPNVPIPLD IMAENIHGSQ LRLTGDTDIT       240
     INDLRLQASN QGQQVDVKTF SVSAPEGSLS LQGTAGLSEQ WPVKLVIKSN TNLNELKGQK       300
     LDLTLNGALL QQLNLALHLS GPIIANLSAQ TELAKAGLPV RLTLESKQLQ WPLTGEPEYR       360
     LDGVKLRLNG KASGYDLSLR SDIKGRDIPP ALLMLDAKGN EELLRLTRLR LSALQGKAEI       420
     TGIVDWSKAI SWNANLILDG INTAKQWPEW PAKMNGKMAI RGSLYGGSWQ LQIPEIALDG       480
     YVKQNIVKAH GKASGNAAGQ WNIPQFDLTF GRNRLNVQGQ LTDEKWKLDG EINAPQLNGL       540
     LPGLSGVVIG NVKLRGNMKA PQIVADLNAR NVRWQNDLKV DSATIKGDVR SAEQIEGQLS       600
     VAVHQLKQAD LIINNLMLNA KGTEKQHDLH LNIEGNPVSG QLALSGRFDR SQERWQGTIN       660
     NTYFDTPVGE WRLNKAMVID YLNPQQKVTI GTHCWLNPNA QICVPKPIEA GASGHAEVVL       720
     KRFDLAMIQP FLDKMTQVKG VFSGNANVKW TAGQALPQAK VVLQGNGVQL HQMVEGAALP       780
     VDFETLTVNA GLTNGKANVA WLFKLAGNGQ LNGNVQVDDL EGRRKLSGNV DIRALSLKLI       840
     KPILGKDEKA EGGLNANLRF GGNVKNPLLF GQLKTDDLQI VSHWLPFDIT QGQLAIYFDG       900
     VRSGLEGVIK TPKGQLNLNG NADWRNLNAW YAKIAANGEK LRVTVPPMVK IDVSPNLVLE       960
     ATPDLLKLDG NVDIPWARIT VQELPESAVG ISSDEVMLDK NLQPIEKKKS SILVKSNLNI      1020
     RIGDDVRLNA FGLKAQLKGV LKVIQDKQGL GLNGQIDIPD GRFHAYGQDL LVRKGTIIFS      1080
     GPPEQPMLNI EAIRNPDSTA NKVVAGVKVT GLADKPKVEI FSEPAKSQQE ALSYLLRGEG      1140
     LEKSGSDNNQ MTSMLIGLGV SQSGQLVGKI GETFGVSDLA LDTQGVGDKS QVVVSGKITN      1200
     NLQVKYGVGI FDSLATLTLR YRVMPRLYLD AVSGIDQALD LLYEFEF                    1247
//

If you have problems or comments...

PBIL Back to PBIL home page