(data stored in ACNUC1104 zone)

EMBL: FN667741.PE35

FN667741.PE35        Location/Qualifiers
FT   CDS             complement(38853..40310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0008"
FT                   /locus_tag="XBJ1_0035"
FT                   /product="Protein viaA (VWA-domain protein interacting with
FT                   AAA ATPase)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0035"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79190"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR023481"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY12"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79190.1"
FT                   /translation="MLTLTTLDLLLSINEGELIEEIILALLSAPQLTIFFEKYPRFKRA
FT                   LLKDVPAWQQTLQQRIKDTLIPASLAEEFQLYQQLLTANTTKFYQQLPDLADKLEQIKS
FT                   PFTHDAHTLREALSEHTHAGQILFIQHWRTSLILQVTTFHKQLLEQEKEQLLAEIQKRL
FT                   DLSGNLDPIFDENDRAAGRLWDMSKGRLHLTSHNTALFTQYAQFLKQQPELEKLAQLLG
FT                   RSQAAKSIPEDSNTLEPFTQIERIPDTVPEQVSGIQQGDDIQRLLPTELAMLGIEELEY
FT                   EFYRRLVDKKLLIYRLQGDNWQPRNILKPMTHHDHAEQPRGPFIVCVDTSGSMGGFNEH
FT                   CAKAFCLALMRIALADNRHCHIILFSTELIHYDLTSQDGLTQAVHFLGQTFKGGTDLAF
FT                   CLNAIIEKMQESIWKDADAVVISDFIAQRLPDVLIHQIQNLQQRQQHRFHAVSLSHYGK
FT                   PGIMQIFDHIWHFDTGVTSRLLRRWRH"
     MLTLTTLDLL LSINEGELIE EIILALLSAP QLTIFFEKYP RFKRALLKDV PAWQQTLQQR        60
     IKDTLIPASL AEEFQLYQQL LTANTTKFYQ QLPDLADKLE QIKSPFTHDA HTLREALSEH       120
     THAGQILFIQ HWRTSLILQV TTFHKQLLEQ EKEQLLAEIQ KRLDLSGNLD PIFDENDRAA       180
     GRLWDMSKGR LHLTSHNTAL FTQYAQFLKQ QPELEKLAQL LGRSQAAKSI PEDSNTLEPF       240
     TQIERIPDTV PEQVSGIQQG DDIQRLLPTE LAMLGIEELE YEFYRRLVDK KLLIYRLQGD       300
     NWQPRNILKP MTHHDHAEQP RGPFIVCVDT SGSMGGFNEH CAKAFCLALM RIALADNRHC       360
     HIILFSTELI HYDLTSQDGL TQAVHFLGQT FKGGTDLAFC LNAIIEKMQE SIWKDADAVV       420
     ISDFIAQRLP DVLIHQIQNL QQRQQHRFHA VSLSHYGKPG IMQIFDHIWH FDTGVTSRLL       480
     RRWRH                                                                   485
//

If you have problems or comments...

PBIL Back to PBIL home page