(data stored in ACNUC1104 zone)

EMBL: FN667741.PE361

FN667741.PE361       Location/Qualifiers
FT   CDS             372699..373121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0074"
FT                   /locus_tag="XBJ1_0366"
FT                   /product="YhbC-like protein (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0366"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79516"
FT                   /db_xref="GOA:D3UYY8"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYY8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79516.1"
FT                   /translation="MISAPVEALGFELVGLEFIRARVSTLRVYIDSEEGITVDNCADVS
FT                   HQVSAVLDVEDPISVLYNLEISSPGLERPLFKAEHYQRFMGEEVSLVLRMAMQNRRRWQ
FT                   GIIKVVDGEMITVTVDGKDEVFALSNIQKANLVPHF"
     MISAPVEALG FELVGLEFIR ARVSTLRVYI DSEEGITVDN CADVSHQVSA VLDVEDPISV        60
     LYNLEISSPG LERPLFKAEH YQRFMGEEVS LVLRMAMQNR RRWQGIIKVV DGEMITVTVD       120
     GKDEVFALSN IQKANLVPHF                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page