(data stored in ACNUC1104 zone)

EMBL: FN667741.PE377

FN667741.PE377       Location/Qualifiers
FT   CDS             complement(395125..396033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0382"
FT                   /product="Regulatory protein, LysR:LysR, substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0382"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79532"
FT                   /db_xref="GOA:D3UZ04"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ04"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79532.1"
FT                   /translation="MVLRNLEDLSVFIRIIDTGSFTATAQALGLSPTTVSKQIARLEKN
FT                   LGVVLFVRSTRSLRITPEGKAIAEKVRAALTLVEEATEIAKDGSESLTGLIRLTAPVPL
FT                   GRTYVAAAIAEFRKKYPSVGFILHLTDKIVDLYKVEMDLAIRVANLTDSGLIARRLTDN
FT                   KRILVASPDYLRLHGELQHPEELINHHCLLFSASGNKSTIWSLHDRKGTKAISLSSDLI
FT                   ANNGDVLRTWCTAGLGIALRETWDVVDLIRAKKLIQILPEWQEETSPINLVRAGKRPVP
FT                   QRIKSFIEFLTEEWRIPPWEK"
     MVLRNLEDLS VFIRIIDTGS FTATAQALGL SPTTVSKQIA RLEKNLGVVL FVRSTRSLRI        60
     TPEGKAIAEK VRAALTLVEE ATEIAKDGSE SLTGLIRLTA PVPLGRTYVA AAIAEFRKKY       120
     PSVGFILHLT DKIVDLYKVE MDLAIRVANL TDSGLIARRL TDNKRILVAS PDYLRLHGEL       180
     QHPEELINHH CLLFSASGNK STIWSLHDRK GTKAISLSSD LIANNGDVLR TWCTAGLGIA       240
     LRETWDVVDL IRAKKLIQIL PEWQEETSPI NLVRAGKRPV PQRIKSFIEF LTEEWRIPPW       300
     EK                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page