(data stored in ACNUC1104 zone)

EMBL: FN667741.PE385

FN667741.PE385       Location/Qualifiers
FT   CDS             401536..401787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0390"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0390"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79540"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ12"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79540.1"
FT                   /translation="MKSVKYIVCILALSAISFGSMAATEVQYAKGEKVGVVSVTGAETL
FT                   DSLTAELSKKADKAGASYFRVISANGQNKLSGVAEIYK"
     MKSVKYIVCI LALSAISFGS MAATEVQYAK GEKVGVVSVT GAETLDSLTA ELSKKADKAG        60
     ASYFRVISAN GQNKLSGVAE IYK                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page